PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g092630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB_related
Protein Properties Length: 300aa    MW: 33327 Da    PI: 10.7646
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g092630.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.6e-081591961047
                      HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
   Csa11g092630.1 159 KLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 196
                      68999******************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.7222878IPR017930Myb domain
SMARTSM007170.243276IPR001005SANT/Myb domain
SuperFamilySSF466893.84E-83377IPR009057Homeodomain-like
CDDcd001672.17E-43574No hitNo description
TIGRFAMsTIGR015573.8E-84477IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-44473IPR009057Homeodomain-like
PROSITE profilePS512949.779148201IPR017930Myb domain
SMARTSM007170.14154199IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-9158200IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-11159200IPR006447Myb domain, plants
PfamPF002491.4E-6159196IPR001005SANT/Myb domain
CDDcd001671.04E-5159197No hitNo description
Gene3DG3DSA:1.10.10.601.9E-6160196IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEVLRPTTSH VSGGNWLMEE TKSNAGVAAS GEGCTWTAAE NKXKYGKGDW RNISRNFVIT  60
RTPTQVASHA QKYFIRQLSG GKDKRRASIH DITTVNIEDE ASLESNKSSI VLGEQRSRLT  120
AXTGSNRVVL FVINGLRLVD RRSWRGRKVF LGRRKNTSKL FLMGLKKYGK GDWRNISRNF  180
VITRTPTQVA SHAQKYFIRQ LSGGKDKRRA SIHDITTVNI EDEASLESNK SSIVLGEQRS  240
RLTAFPWNET DNNGTHADAF NITIGNAISG VHSYGQVMLG GFNNAADSCY NAQNTMFQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1188911e-178AK118891.1 Arabidopsis thaliana At5g58900 mRNA for putative I-box binding factor, complete cds, clone: RAFL21-22-M07.
GenBankAY5195331e-178AY519533.1 Arabidopsis thaliana MYB transcription factor (At5g58900) mRNA, complete cds.
GenBankBT0054731e-178BT005473.1 Arabidopsis thaliana clone U51211 putative I-box binding factor (At5g58900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446188.11e-129PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-41DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0GRH61e-117R0GRH6_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__1829__AT5G58900.11e-113(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-116Homeodomain-like transcriptional regulator